제품 > 항체 > 단일클론항체(mAb)

Integrin alpha 3/CD49c Rabbit mAb (A26152)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using Integrin alpha 3/CD49c Rabbit mAb (A26152) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Integrin alpha 3/CD49c Rabbit mAb (A26152) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Integrin alpha 3/CD49c Rabbit mAb (A26152) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Flow CytoMetry - Integrin alpha 3/CD49c Rabbit mAb (A26152)

Flow cytometry: 1X10^6 K-562 cells (negative control, left) and A-431 cells (right) were surface-stained with Integrin alpha 3/CD49c Rabbit mAb (A26152, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by PE Donkey anti-Rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 A-431 cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or Integrin alpha 3/CD49c Rabbit mAb (A26152, 2 μg/mL, right), followed by PE Donkey anti-Rabbit pAb staining.

Overview

Product name	Integrin alpha 3/CD49c Rabbit mAb
Catalog No.	A26152
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67523

Background

The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function as cell surface adhesion molecules. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 3 subunit. This subunit joins with a beta 1 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. Expression of this gene may be correlated with breast cancer metastasis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 466-620 of human Integrin alpha 3/CD49c (NP_002195.1).
Sequence	INIVHKTLVPRPAVLDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQALENHTEVQFQKECGPDNK
Gene ID
Swiss Prot
Synonyms	JEB7; VL3A; CD49C; FRP-2; GAPB3; ILNEB; MSK18; VCA-2; VLA3a; GAP-B3
Calculated MW	117kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200 FC 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3
Key application	Immunohistochemistry Flow Cytometry
Positive samples
Cellular location	Cell membrane, Cell projection, Lipid-anchor, Single-pass type I membrane protein, filopodium membrane, invadopodium membrane.