Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Integrin alpha 6 (ITGA6/CD49f) Rabbit mAb |
---|---|
Catalog No. | A19070 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51523 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 481-591 of human Integrin alpha 6 (ITGA6/CD49f) (NP_001073286.1). |
---|---|
Sequence | IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP |
Gene ID | |
Swiss Prot | |
Synonyms | JEB6; CD49f; VLA-6; ITGA6A; ITGA6B; Integrin alpha 6 (ITGA6/CD49f) |
Calculated MW | 106kDa/119kDa/121kDa/122kDa/124kDa/126kDa |
Observed MW | 125kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-251MG, SW480, mouse lung, rat lung, rat kidney |
Cellular location | Cell membrane, Lipid-anchor, Single-pass type I membrane protein. |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19070? Please let us know so that we can cite the reference in this datasheet.