Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Integrin alpha-6/ITGA6 Rabbit mAb (A26707)at 1:5000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): K-562
Exposure time: 30s.
Western blot analysis of various lysates using Integrin alpha-6/ITGA6 Rabbit mAb (A26707) at 1:5000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Integrin alpha-6/ITGA6 Rabbit mAb (A26707) at a dilution of 1：200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using Integrin alpha-6/ITGA6 Rabbit mAb (A26707) at a dilution of 1：200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Integrin alpha-6/ITGA6 Rabbit mAb (A26707) at a dilution of 1：200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Integrin alpha-6/ITGA6 Rabbit mAb (A26707) at a dilution of 1：200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Mouse lung tissue using Integrin alpha-6/ITGA6 Rabbit mAb (A26707, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.
| Product name | Integrin alpha-6/ITGA6 Rabbit mAb |
|---|---|
| Catalog No. | A26707 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC69398 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 505-663 of human Integrin alpha-6/ITGA6 (NP_000201.2). |
|---|---|
| Sequence | YTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPE |
| Gene ID | |
| Swiss Prot | |
| Synonyms | JEB6; CD49f; VLA-6; ITGA6A; ITGA6B |
| Calculated MW | 127kDa |
| Observed MW | 127kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse lung, Mouse large intestine, Rat thymus, Rat lung, BeWo |
| Cellular location | Cell membrane, Lipid-anchor, Single-pass type I membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
