제품 > 항체 > 다중클론항체(pAb)

JAB1/CSN5/COPS5 Rabbit pAb (A13401)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using JAB1/CSN5/JAB1/CSN5/COPS5 antibody (A13401) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - JAB1/CSN5/COPS5 Rabbit pAb (A13401)

Immunofluorescence analysis of HeLa cells using JAB1/CSN5/JAB1/CSN5/COPS5 antibody (A13401). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of C6 cells using JAB1/CSN5/JAB1/CSN5/COPS5 antibody (A13401) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using JAB1/CSN5/JAB1/CSN5/COPS5 antibody (A13401) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	JAB1/CSN5/COPS5 Rabbit pAb
Catalog No.	A13401
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-334 of human JAB1/CSN5/JAB1/CSN5/COPS5 (NP_006828.2).
Sequence	MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS
Gene ID
Swiss Prot
Synonyms	CSN5; JAB1; SGN5; MOV-34
Calculated MW	38kDa
Observed MW	37kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	NIH/3T3, MCF7, PC-12, HeLa, K-562, DU145, Mouse brain, Mouse heart, Mouse testis
Cellular location	Cytoplasm, Cytoplasmic vesicle, Nucleus, perinuclear region, secretory vesicle, synaptic vesicle