제품 > 항체 > 다중클론항체(pAb)

JAM-A/CD321 Rabbit pAb (A23909)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from A-431 cells, using JAM-A/CD321 Rabbit pAb (A23909) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	JAM-A/CD321 Rabbit pAb
Catalog No.	A23909
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable PDZ domain binding activity; integrin binding activity; and protein homodimerization activity. Involved in intestinal absorption; regulation of cytokine production; and regulation of membrane permeability. Acts upstream of or within cell adhesion and epithelial cell differentiation. Located in bicellular tight junction. Is expressed in several structures, including 4-8 cell stage embryo; alimentary system; respiratory system; sensory organ; and urinary system. Human ortholog(s) of this gene implicated in hypertension. Orthologous to human F11R (F11 receptor).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 27-242 of mouse JAM-A/CD321. (NP_001193762.1).
Sequence	KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAA
Gene ID
Swiss Prot
Synonyms	JAM; Jcam; JAM-1; JAM-A; Jcam1; Ly106; ESTM33; 9130004G24; JAM-A/CD321
Calculated MW	32kDa
Observed MW	36-41kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A-431
Cellular location