제품 > 항체 > 다중클론항체(pAb)

JTB Rabbit pAb (A10427)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of extracts of various cell lines, using JTB antibody (A10427) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Overview

Product name	JTB Rabbit pAb
Catalog No.	A10427
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables protein kinase binding activity. Involved in mitotic cytokinesis and positive regulation of protein kinase activity. Located in cytoplasm and midbody. Colocalizes with centrosome and spindle.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 31-105 of human JTB (NP_006685.1).
Sequence	EAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL
Gene ID
Swiss Prot
Synonyms	PAR; hJT; HJTB; HSPC222
Calculated MW	16kDa
Observed MW	16kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	MCF7, NCI-H460, A375, Rat spleen, Rat thymus
Cellular location	Cytoplasm, Membrane, Mitochondrion, Single-pass type I membrane protein, centrosome, cytoskeleton, microtubule organizing center, spindle