제품 > 항체 > 단일클론항체(mAb)

KAT1/HAT1 Rabbit mAb (A4423)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using KAT1/HAT1 Rabbit mAb (A4423) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - KAT1/HAT1 Rabbit mAb (A4423)

Immunohistochemistry analysis of KAT1/HAT1 in paraffin-embedded human cervix cancer tissue using KAT1/HAT1 Rabbit mAb (A4423) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KAT1/HAT1 in paraffin-embedded human colon tissue using KAT1/HAT1 Rabbit mAb (A4423) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KAT1/HAT1 in paraffin-embedded mouse testis tissue using KAT1/HAT1 Rabbit mAb (A4423) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KAT1/HAT1 in paraffin-embedded rat colon tissue using KAT1/HAT1 Rabbit mAb (A4423) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - KAT1/HAT1 Rabbit mAb (A4423)

Immunofluorescence analysis of C6 cells using KAT1/HAT1 Rabbit mAb (A4423) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using KAT1/HAT1 Rabbit mAb (A4423) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	KAT1/HAT1 Rabbit mAb
Catalog No.	A4423
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1002

Background

The protein encoded by this gene is a type B histone acetyltransferase (HAT) that is involved in the rapid acetylation of newly synthesized cytoplasmic histones, which are in turn imported into the nucleus for de novo deposition onto nascent DNA chains. Histone acetylation, particularly of histone H4, plays an important role in replication-dependent chromatin assembly. Specifically, this HAT can acetylate soluble but not nucleosomal histone H4 at lysines 5 and 12, and to a lesser degree, histone H2A at lysine 5. Alternatively spliced transcript variants have been identified for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 200-400 of human KAT1/HAT1 (NP_003633.2).
Sequence	HYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMVIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEE
Gene ID
Swiss Prot
Synonyms	KAT1
Calculated MW	50kDa
Observed MW	49kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	MCF7, U-87MG, Mouse testis, Rat thymus
Cellular location	Cytoplasm, Nucleus, Nucleus matrix, nucleoplasm