제품 > 항체 > 다중클론항체(pAb)

KATNB1 Rabbit pAb (A21041)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of extracts of various cell lines, using KATNB1 antibody (A21041) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - KATNB1 Rabbit pAb (A21041)

Immunofluorescence analysis of NIH/3T3 cells using KATNB1 Rabbit pAb (A21041) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	KATNB1 Rabbit pAb
Catalog No.	A21041
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1). The p60 subunit acts to sever and disassemble microtubules, while the p80 subunit targets the enzyme to the centrosome. Katanin is a member of the AAA family of ATPases.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 400-500 of human KATNB1 (NP_005877.2).
Sequence	SEPFPAPPEDDAATAKEAAKPSPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQIRKGHDTMCV
Gene ID
Swiss Prot
Synonyms	KAT; LIS6
Calculated MW	72kDa
Observed MW	72kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse testis, Rat testis
Cellular location	centrosome, cytoplasm, cytosol, katanin complex, microtubule cytoskeleton, nucleus, plasma membrane, spindle, spindle pole