제품 > 항체 > 다중클론항체(pAb)

KBTBD3 Rabbit pAb (A2152)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of PC-3 cells, using KBTBD3 antibody (A2152).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Overview

Product name	KBTBD3 Rabbit pAb
Catalog No.	A2152
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Is expressed in several structures, including central nervous system; dorsal root ganglion; early conceptus; genitourinary system; and tooth. Orthologous to human KBTBD3 (kelch repeat and BTB domain containing 3).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 410-607 of mouse KBTBD3 (NP_081238.2).
Sequence	GSQDIKSLLDVESYNPLSREWTSVSPLPRGIYYPEASACQNIIYVLGSEVEIADAFNPSLDCFFKYNATTDQWSELVAEFGQFFHATLIKAVPVNCTLYICDLSTYKVYSFCPDTCVWKGEGSFECAGFNAGAIGIEDKIYILGGDYAPDEITDEVQVYHSSRSEWEEVSPMPRALTEFYCQVIQFNKYRDPWYSNHF
Gene ID
Swiss Prot
Synonyms	Bklhd3; 2200003A07Rik
Calculated MW	69kDa
Observed MW	69kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	PC-3
Cellular location