제품 > 항체 > 다중클론항체(pAb)

KCNMB1 Rabbit pAb (A10224)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of various cell lines, using KCNMB1 antibody (A10224) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Overview

Product name	KCNMB1 Rabbit pAb
Catalog No.	A10224
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the product of this gene, the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-102 of human KCNMB1 (NP_004128.1).
Sequence	TYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQ
Gene ID
Swiss Prot
Synonyms	hbeta1; BKbeta1; SLO-BETA; hslo-beta; K(VCA)beta; slo-beta-1; k(VCA)beta-1
Calculated MW	22kDa
Observed MW	18kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, THP-1, MCF7
Cellular location	Membrane, Multi-pass membrane protein