제품 > 항체 > 다중클론항체(pAb)

KDM1 Rabbit pAb (A1156)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from MCF7 cells, using KDM1 Rabbit pAb (A1156) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).

ABclonal:Immunoprecipitation - KDM1 Rabbit pAb (A1156)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 3 μg KDM1 antibody (A1156). Western blot was performed from the immunoprecipitate using KDM1 antibody (A1156) at a dilution of 1:500.

Overview

Product name	KDM1 Rabbit pAb
Catalog No.	A1156
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 365-515 of human KDM1 (NP_055828.2).
Sequence	ANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANP
Gene ID
Swiss Prot
Synonyms	AOF2; CPRF; KDM1; LSD1; BHC110
Calculated MW	93kDa
Observed MW	117kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	MCF7, 293T
Cellular location	Nucleus.
Customer validation	WB(Mus musculus, Homo sapiens) IP(Homo sapiens)