Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | KDM1 / LSD1 Rabbit mAb |
---|---|
Catalog No. | A8711 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1160 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 700-811 of human KDM1 / LSD1 (NP_055828.2). |
---|---|
Sequence | APILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATV |
Gene ID | |
Swiss Prot | |
Synonyms | AOF2; CPRF; KDM1; LSD1; BHC110; KDM1 / LSD1 |
Calculated MW | 93kDa |
Observed MW | 110kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa, Jurkat, SH-SY5Y |
Cellular location | nucleoplasm, nucleus. |
Customer validation | WB(Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A8711? Please let us know so that we can cite the reference in this datasheet.