제품 > 항체 > 단일클론항체(mAb)

KDM4B/JMJD2B Rabbit mAb (A6670)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using KDM4B/JMJD2B Rabbit mAb (A6670) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - KDM4B/JMJD2B Rabbit mAb (A6670)

Immunofluorescence analysis of C6 cells using KDM4B/JMJD2B Rabbit mAb (A6670) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using KDM4B/JMJD2B Rabbit mAb (A6670) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - KDM4B/JMJD2B Rabbit mAb (A6670)

Immunoprecipitation analysis of 300 μg extracts of HCT116 cells using 3 μg KDM4B/JMJD2B antibody (A6670). Western blot was performed from the immunoprecipitate using KDM4B/JMJD2B antibody (A6670) at a dilution of 1:1000.

ABclonal:Chromatin Immunoprecipitation - KDM4B/JMJD2B Rabbit mAb (A6670)

Chromatin immunoprecipitation analysis of extracts of 5637; cells, using KDM4B/JMJD2B antibody (A6670) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	KDM4B/JMJD2B Rabbit mAb
Catalog No.	A6670
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1416

Background

Enables histone H3-methyl-lysine-36 demethylase activity and histone H3-methyl-lysine-9 demethylase activity. Involved in histone H3-K36 demethylation and histone H3-K9 demethylation. Located in cytosol and nucleoplasm. Implicated in autosomal dominant non-syndromic intellectual disability; breast cancer; colorectal cancer; malignant peripheral nerve sheath tumor; and stomach cancer. Biomarker of several diseases, including alopecia areata; lung cancer; medulloblastoma; prostate cancer; and stomach cancer.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KDM4B/JMJD2B (O94953).
Sequence	PPKEWKPRQTYDDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLERKYWKNLTFVSPIYGADISGSLYDDDVAQWN
Gene ID
Swiss Prot
Synonyms	MRD65; JMJD2B; TDRD14B; KDM4B/JMJD2B
Calculated MW	122kDa
Observed MW	150kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HCT 116, Mouse brain
Cellular location	Nucleus.
Customer validation	WB(Homo sapiens, Mus musculus) IHC(Mus musculus) ChIP(Homo sapiens,Mus musculus) PCR(Homo sapiens,Mus musculus)