Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from wild type (WT) and IGF1R knockdown (KD) 293T cells using [KD Validated] IGF1R Rabbit pAb (A0243) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of various lysates using [KD Validated] IGF1R Rabbit pAb (A0243) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
| Product name | [KD Validated] IGF1R Rabbit pAb |
|---|---|
| Catalog No. | A0243 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1201-1367 of human IGF1R (NP_000866.1). |
|---|---|
| Sequence | VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC |
| Gene ID | |
| Swiss Prot | |
| Synonyms | IGFR; CD221; IGFIR; JTK13; 1R |
| Calculated MW | 155kDa |
| Observed MW | 100kDa/ |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | 293T, HeLa, A375 |
| Cellular location | Cell membrane, Single-pass type I membrane protein. |
| Customer validation | WB(Homo sapiens, Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0243? Please let us know so that we can cite the reference in this datasheet.
![ABclonal:Western blot - [KD Validated] IGF1R Rabbit pAb (A0243)](https://img.abclonal.com/abclonal-manage/Catalog/A0243/A0243_1.jpg?t=1726708592 "ABclonal:Western blot - [KD Validated] IGF1R Rabbit pAb (A0243)")
![ABclonal:Western blot - [KD Validated] IGF1R Rabbit pAb (A0243)](https://img.abclonal.com/abclonal-manage/Catalog/A0243/A0243_2.jpg?t=1726708592 "ABclonal:Western blot - [KD Validated] IGF1R Rabbit pAb (A0243)")
