제품 > 항체 > 단일클론항체(mAb)

[KD Validated] JNK1 Rabbit mAb (A21888)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KD Validated] JNK1 Rabbit mAb (A21888) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of lysates from wild type(WT) and JNK1 knockdown (KD) 293T cells, using [KD Validated] JNK1 Rabbit mAb (A21888) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunoprecipitation - [KD Validated] JNK1 Rabbit mAb (A21888)

Immunoprecipitation of [KD Validated] JNK1 from 500 µg extracts of C6 cells was performed using 2 µg of [KD Validated] JNK1 Rabbit mAb (A21888). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X non-reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KD Validated] JNK1 Rabbit mAb (A21888) at a dilution of 1:1000.

Overview

Product name	[KD Validated] JNK1 Rabbit mAb
Catalog No.	A21888
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2908

Background

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human JNK1 (P45983).
Sequence	KKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIE
Gene ID
Swiss Prot
Synonyms	JNK; [KD Validated] JNK1
Calculated MW	48kDa
Observed MW	46kDa/54kDa/42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	293T, C6, Neuro-2a, Mouse brain, Rat testis, Rat brain, C6
Cellular location	Cytoplasm, Nucleus
Customer validation	WB( Bos taurus,Homo sapiens)