Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KD Validated] JNK1 Rabbit mAb |
---|---|
Catalog No. | A21888 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2908 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human JNK1 (P45983). |
---|---|
Sequence | KKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIE |
Gene ID | |
Swiss Prot | |
Synonyms | JNK; [KD Validated] JNK1 |
Calculated MW | 48kDa |
Observed MW | 46kDa/54kDa/42kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | 293T, C6, Neuro-2a, Mouse brain, Rat testis, Rat brain, C6 |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB( Bos taurus,Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21888? Please let us know so that we can cite the reference in this datasheet.