제품 > 항체 > 단일클론항체(mAb)

[KD Validated] MCT1 Rabbit mAb (A27270)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and MCT1 knockdown (KD) 293T cells using [KD Validated] MCT1 Rabbit mAb (A27270) at 1:2000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - [KD Validated] MCT1 Rabbit mAb (A27270)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KD Validated] MCT1 Rabbit mAb (A27270) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KD Validated] MCT1 Rabbit mAb (A27270) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using [KD Validated] MCT1 Rabbit mAb (A27270) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	[KD Validated] MCT1 Rabbit mAb
Catalog No.	A27270
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC72781

Background

The protein encoded by this gene is a proton-linked monocarboxylate transporter that catalyzes the movement of many monocarboxylates, such as lactate and pyruvate, across the plasma membrane. Mutations in this gene are associated with erythrocyte lactate transporter defect. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 190-245 of human MCT1 (NP_003042.3).
Sequence	VAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSV
Gene ID
Swiss Prot
Synonyms	MCT; HHF7; MCT1; MCT1D
Calculated MW	54kDa
Observed MW	43kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:8000 IHC-P 1:200 - 1:800
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T
Cellular location	apical plasma membrane, basal plasma membrane, , cell junction, centrosome, extracellular exosome, lateral plasma membrane, plasma membrane, Cell membrane, Multi-pass membrane protein.
Customer validation	WB(Homo sapiens)