Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | [KD Validated] MCT1 Rabbit mAb |
---|---|
Catalog No. | A27270 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC72781 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 190-245 of human MCT1 (NP_003042.3). |
---|---|
Sequence | VAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSV |
Gene ID | |
Swiss Prot | |
Synonyms | MCT; HHF7; MCT1; MCT1D |
Calculated MW | 54kDa |
Observed MW | 43kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | 293T |
Cellular location | apical plasma membrane, basal plasma membrane, , cell junction, centrosome, extracellular exosome, lateral plasma membrane, plasma membrane, Cell membrane, Multi-pass membrane protein. |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A27270? Please let us know so that we can cite the reference in this datasheet.