Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of extracts of various cell lines, using MLST8 antibody (A1059) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Western blot analysis of various lysates, using MLST8 Rabbit pAb (A1059) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts from wild type(WT) and MLST8 knockdown (KD) 293T cells, using MLST8 Rabbit pAb (A1059) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
| Product name | [KD Validated] MLST8 Rabbit pAb |
|---|---|
| Catalog No. | A1059 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-326 of human MLST8 (NP_001186103.1). |
|---|---|
| Sequence | MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | GBL; LST8; POP3; WAT1; GbetaL |
| Calculated MW | 36kDa |
| Observed MW | 37kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | 293T, HeLa, K-562, 22Rv1, Mouse brain, Mouse kidney, Mouse thymus, Rat brain, Rat testis |
| Cellular location | Cytoplasm |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
![ABclonal:Western blot - [KD Validated] MLST8 Rabbit pAb (A1059)](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1059/A1059_1.jpg?t=1690971640 "ABclonal:Western blot - [KD Validated] MLST8 Rabbit pAb (A1059)")
![ABclonal:Western blot - [KD Validated] MLST8 Rabbit pAb (A1059)](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1059/A1059_2.jpg?t=1690971646 "ABclonal:Western blot - [KD Validated] MLST8 Rabbit pAb (A1059)")
![ABclonal:Western blot - [KD Validated] MLST8 Rabbit pAb (A1059)](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A1059/A1059_3.jpg?t=1690971660 "ABclonal:Western blot - [KD Validated] MLST8 Rabbit pAb (A1059)")
