Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from wild type (WT) and MRPL9 knockdown (KD) HeLa cells using [KD Validated] MRPL9 Rabbit pAb (A25241) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of lysates from MCF7 cells using [KD Validated] MRPL9 Rabbit pAb(A25241) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
| Product name | [KD Validated] MRPL9 Rabbit pAb |
|---|---|
| Catalog No. | A25241 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to a sequence within amino acids 53-267 of human MRPL9 (NP_113608.1). |
|---|---|
| Sequence | TVIVERWWKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKIQTKAGEATVKFLKSCRLEVGMKNNVKWELNPEIVARHFFKNLGVVVAPHTLKLPEEPITRWGEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKYWLAQQAAKAMAPTSPQI |
| Gene ID | |
| Swiss Prot | |
| Synonyms | L9mt; MRPL9 |
| Calculated MW | 30kDa |
| Observed MW | 30kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | HeLa, MCF7 |
| Cellular location | Mitochondrion |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
![ABclonal:Western blot - [KD Validated] MRPL9 Rabbit pAb (A25241)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25241_N31322-4_WB_01.jpg?t=1706146441 "ABclonal:Western blot - [KD Validated] MRPL9 Rabbit pAb (A25241)")
![ABclonal:Western blot - [KD Validated] MRPL9 Rabbit pAb (A25241)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25241_N31322-4_WB_02.jpg?t=1706146441 "ABclonal:Western blot - [KD Validated] MRPL9 Rabbit pAb (A25241)")
![ABclonal:Immunofluorescence - [KD Validated] MRPL9 Rabbit pAb (A25241)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25241_N31320-4_IF_01.jpg?t=1706146441 "ABclonal:Immunofluorescence - [KD Validated] MRPL9 Rabbit pAb (A25241)")
