제품 > 항체 > 단일클론항체(mAb)

[KD Validated] POLR2L Rabbit mAb (A25872)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KD Validated] POLR2L Rabbit mAb (A25872) at 1:2200 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

Western blot analysis of lysates from 293T cells transfected with POLR2L siRNA using [KD Validated] POLR2L Rabbit mAb (A25872) at 1:2000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
.Exposure time: 1s.

ABclonal:Immunohistochemistry - [KD Validated] POLR2L Rabbit mAb (A25872)

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using [KD Validated] POLR2L Rabbit mAb (A25872) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using [KD Validated] POLR2L Rabbit mAb (A25872) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using [KD Validated] POLR2L Rabbit mAb (A25872) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	[KD Validated] POLR2L Rabbit mAb
Catalog No.	A25872
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63914

Background

This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart in yeast, this subunit may be shared by the other two DNA-directed RNA polymerases.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-67 of human POLR2L (NP_066951.1).
Sequence	MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Gene ID
Swiss Prot
Synonyms	RBP10; RPB10; RPABC5; RPB7.6; hRPB7.6; RPB10beta
Calculated MW	8kDa
Observed MW	10kDa/8kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:8000 IHC-P 1:200 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, 293T, Mouse kidney
Cellular location	Nucleus, nucleolus.