제품 > 항체 > 단일클론항체(mAb)

[KD Validated] TIMM13 Rabbit mAb (A25135)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and TIMM13 knockdown (KD) HeLa cells using [KD Validated] TIMM13 Rabbit mAb (A25135) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of lysates from 293T cells using [KD Validated] TIMM13 Rabbit mAb(A25135) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - [KD Validated] TIMM13 Rabbit mAb (A25135)

Confocal imaging of HeLa cells using [KD Validated] TIMM13 Rabbit mAb (A25135, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Overview

Product name	[KD Validated] TIMM13 Rabbit mAb
Catalog No.	A25135
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65133

Background

This gene encodes a member of the evolutionarily conserved TIMM (translocase of inner mitochondrial membrane) family of proteins that function as chaperones in the import of proteins from the cytoplasm into the mitochondrial inner membrane. Proteins of this family play a role in collecting substrate proteins from the translocase of the outer mitochondrial membrane (TOM) complex and delivering them to either the sorting and assembly machinery in the outer mitochondrial membrane (SAM) complex or the TIMM22 complex in the inner mitochondrial membrane. The encoded protein and the translocase of mitochondrial inner membrane 8a protein form a 70 kDa complex in the intermembrane space.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human TIMM13 (NP_036590.1).
Sequence	MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
Gene ID
Swiss Prot
Synonyms	TWIST1; ACS3; BPES2; BPES3; CRS; CRS1; CSO; SCS; TWIST; bHLHa38; twist-related protein 1
Calculated MW	11kDa
Observed MW	11kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, 293T
Cellular location	Intermembrane side, Mitochondrion inner membrane, Peripheral membrane protein