제품 > 항체 > 단일클론항체(mAb)

[KD Validated] Thymidylate synthase Rabbit mAb (A24168)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and Thymidylate synthase knockdown (KD) 293T cells using [KD Validated] Thymidylate synthase Rabbit mAb (A24168) at 1:5000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - [KD Validated] Thymidylate synthase Rabbit mAb (A24168)

Immunohistochemistry analysis of Thymidylate synthase in paraffin-embedded human colon tissue using [KD Validated] Thymidylate synthase Rabbit mAb (A24168) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Thymidylate synthase in paraffin-embedded human tonsil tissue using [KD Validated] Thymidylate synthase Rabbit mAb (A24168) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Thymidylate synthase in paraffin-embedded human spleen tissue using [KD Validated] Thymidylate synthase Rabbit mAb (A24168) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Thymidylate synthase in paraffin-embedded human cervix cancer tissue using [KD Validated] Thymidylate synthase Rabbit mAb (A24168) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	[KD Validated] Thymidylate synthase Rabbit mAb
Catalog No.	A24168
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65474

Background

Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using, 10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occurring antisense transcript, mitochondrial enolase superfamily member 1 (GeneID:55556), vary inversely when cell-growth progresses from late-log to plateau phase. Polymorphisms in this gene may be associated with etiology of neoplasia, including breast cancer, and response to chemotherapy.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-313 of human Thymidylate synthase(NP_001062.1).
Sequence	MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV
Gene ID
Swiss Prot
Synonyms	TS; TMS; DKCD; HST422; [KD Validated] Thymidylate synthase
Calculated MW	36kDa
Observed MW	36kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:6000 IHC-P 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T
Cellular location	Cytoplasm, Mitochondrion, Mitochondrion inner membrane, Mitochondrion matrix, Nucleus