제품 > 항체 > 단일클론항체(mAb)

Thymidylate synthase Rabbit mAb (A24167)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Immunohistochemistry analysis of Thymidylate synthase in paraffin-embedded rat spleen tissue using Thymidylate synthase Rabbit mAb (A24167) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Thymidylate synthase in paraffin-embedded mouse spleen tissue using Thymidylate synthase Rabbit mAb (A24167) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Thymidylate synthase in paraffin-embedded human colon carcinoma tissue using Thymidylate synthase Rabbit mAb (A24167) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Thymidylate synthase Rabbit mAb (A24167)

Confocal imaging of U-2 OS cells using Thymidylate synthase Rabbit mAb (A24167, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Overview

Product name	Thymidylate synthase Rabbit mAb
Catalog No.	A24167
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65465

Background

Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using, 10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occurring antisense transcript, mitochondrial enolase superfamily member 1 (GeneID:55556), vary inversely when cell-growth progresses from late-log to plateau phase. Polymorphisms in this gene may be associated with etiology of neoplasia, including breast cancer, and response to chemotherapy.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-313 of human Thymidylate synthase(NP_001062.1).
Sequence	MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV
Gene ID
Swiss Prot
Synonyms	TS; TMS; DKCD; HST422; Thymidylate synthase
Calculated MW	36kDa
Observed MW	36kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunohistochemistry Immunofluorescence
Positive samples	C6
Cellular location	Cytoplasm, Mitochondrion, Mitochondrion inner membrane, Mitochondrion matrix, Nucleus