제품 > 항체 > 단일클론항체(mAb)

[KD Validated] YTHDC1 Rabbit mAb (A22992)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KD Validated] YTHDC1 Rabbit mAb (A22992) at 1:2000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from wild type (WT) and YTHDC1 knockdown (KD) HeLa cells using [KD Validated] YTHDC1 Rabbit mAb (A22992) at 1:3000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - [KD Validated] YTHDC1 Rabbit mAb (A22992)

Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using [KD Validated] YTHDC1 Rabbit mAb (A22992) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using [KD Validated] YTHDC1 Rabbit mAb (A22992) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KD Validated] YTHDC1 Rabbit mAb (A22992) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human small intestine tissue using [KD Validated] YTHDC1 Rabbit mAb (A22992) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KD Validated] YTHDC1 Rabbit mAb (A22992) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using [KD Validated] YTHDC1 Rabbit mAb (A22992) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Overview

Product name	[KD Validated] YTHDC1 Rabbit mAb
Catalog No.	A22992
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59465

Background

Enables N6-methyladenosine-containing RNA binding activity. Involved in mRNA export from nucleus; mRNA splice site selection; and regulation of gene expression. Located in nuclear speck and plasma membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-71 of human YTHDC1 (NP_001026902.1).
Sequence	MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLVS
Gene ID
Swiss Prot
Synonyms	YT521; YT521-B; [KD Validated] YTHDC1
Calculated MW	85kDa
Observed MW	110kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:8000 IHC-P 1:500 - 1:5000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	K-562, U-87MG, HeLa
Cellular location	Nucleus.