제품 > 항체 > 단일클론항체(mAb)

KHSRP Rabbit mAb (A9075)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using KHSRP Rabbit mAb (A9075) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - KHSRP Rabbit mAb (A9075)

Immunohistochemistry analysis of KHSRP in paraffin-embedded human breast cancer tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KHSRP in paraffin-embedded human breast tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KHSRP in paraffin-embedded human esophagus tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KHSRP in paraffin-embedded human thyroid tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse colon tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse heart tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse liver tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse spleen tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KHSRP in paraffin-embedded rat colon tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KHSRP in paraffin-embedded rat liver tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunoprecipitation - KHSRP Rabbit mAb (A9075)

Immunoprecipitation analysis of 300 μg extracts of HepG2 cells using 3 μg KHSRP antibody (A9075). Western blot was performed from the immunoprecipitate using KHSRP antibody (A9075) at a dilution of 1:1000.

Overview

Product name	KHSRP Rabbit mAb
Catalog No.	A9075
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1402

Background

The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization (Min et al., 1997 [PubMed 9136930]; Gherzi et al., 2004 [PubMed 15175153]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human KHSRP (Q92945).
Sequence	MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQI
Gene ID
Swiss Prot
Synonyms	p75; FBP2; KSRP; FUBP2; KHSRP
Calculated MW	73kDa
Observed MW	82kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	Hep G2, C2C12, Mouse brain, Rat brain
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Other)