Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using KHSRP Rabbit mAb (A9075) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of KHSRP in paraffin-embedded human breast cancer tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of KHSRP in paraffin-embedded human breast tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of KHSRP in paraffin-embedded human esophagus tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of KHSRP in paraffin-embedded human thyroid tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse colon tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse heart tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse liver tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse spleen tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of KHSRP in paraffin-embedded rat colon tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of KHSRP in paraffin-embedded rat liver tissue using KHSRP Rabbit mAb (A9075) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Product name | KHSRP Rabbit mAb |
|---|---|
| Catalog No. | A9075 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC1402 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human KHSRP (Q92945). |
|---|---|
| Sequence | MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQI |
| Gene ID | |
| Swiss Prot | |
| Synonyms | p75; FBP2; KSRP; FUBP2; KHSRP |
| Calculated MW | 73kDa |
| Observed MW | 82kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunoprecipitation |
| Positive samples | Hep G2, C2C12, Mouse brain, Rat brain |
| Cellular location | Cytoplasm, Nucleus |
| Customer validation | WB(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A9075? Please let us know so that we can cite the reference in this datasheet.
