Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | KIF23 Rabbit mAb |
---|---|
Catalog No. | A4896 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0335 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 801-960 of human KIF23 (Q02241). |
---|---|
Sequence | NAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQESPNGSRKRRSSTVAPAQPDGAESEWTDVETRCSVAVEMRAGSQLGPGYQHHAQPKRKKP |
Gene ID | |
Swiss Prot | |
Synonyms | CDA3; CHO1; CDAN3; KNSL5; MKLP1; CDAIII; CDAN3A; MKLP-1; KIF23 |
Calculated MW | 110kDa |
Observed MW | 115kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | HeLa, Rat testis |
Cellular location | Cytoplasm, Midbody, Nucleus, cytoskeleton, spindle |
Customer validation | WB(Rattus norvegicus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4896? Please let us know so that we can cite the reference in this datasheet.