제품 > 항체 > 다중클론항체(pAb)

[KO Validated] ATPIF1 Rabbit pAb (A5099)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from wild type(WT) and ATPIF1 knockout (KO) 293T(KO) cells, using [KO Validated] ATPIF1 Rabbit pAb (A5099) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - [KO Validated] ATPIF1 Rabbit pAb (A5099)

Immunofluorescence analysis of U2OS cells using [KO Validated] ATPIF1 Rabbit pAb (A5099) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] ATPIF1 Rabbit pAb (A5099)

Immunoprecipitation analysis of 300 μg extracts of K-562 cells using 3 μg [KO Validated] ATPIF1 Rabbit pAb (A5099). Western blot was performed from the immunoprecipitate using [KO Validated] ATPIF1 Rabbit pAb (A5099) at a dilition of 1:3000.

Overview

Product name	[KO Validated] ATPIF1 Rabbit pAb
Catalog No.	A5099
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including ATPase binding activity; angiostatin binding activity; and mitochondrial proton-transporting ATP synthase complex binding activity. Involved in several processes, including mitochondrial depolarization; negative regulation of ATPase activity; and regulation of protein targeting to mitochondrion. Located in cell surface and mitochondrion.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 26-106 of human ATPIF1 (NP_057395.1).
Sequence	GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD
Gene ID
Swiss Prot
Synonyms	IP; ATPI; ATPIP; ATPIF1; F1
Calculated MW	12kDa
Observed MW	12kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	293T
Cellular location	Mitochondrion