제품 > 항체 > 다중클론항체(pAb)

[KO Validated] CDK5 Rabbit pAb (A5730)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KO Validated] CDK5 Rabbit pAb (A5730) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from wild type (WT) and CDK5 knockout (KO) 293T cells, using [KO Validated] CDK5 Rabbit pAb (A5730) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - [KO Validated] CDK5 Rabbit pAb (A5730)

Immunofluorescence analysis of U2OS cells using [KO Validated] CDK5 Rabbit pAb (A5730). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] CDK5 Rabbit pAb (A5730)

Immunoprecipitation analysis of 900 μg extracts of A-549 cells using 3 μg CDK5 antibody (A5730). Western blot was performed from the immunoprecipitate using CDK5 antibody (A5730) at a dilution of 1:1000.

Overview

Product name	[KO Validated] CDK5 Rabbit pAb
Catalog No.	A5730
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of human CDK5 (NP_004926.1).
Sequence	MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Gene ID
Swiss Prot
Synonyms	LIS7; PSSALRE; K5
Calculated MW	33kDa
Observed MW	30kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:10 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	293T, HepG2, BT-474, A-549, PC-12, Mouse brain, Rat brain
Cellular location	Cell junction, Cell membrane, Cell projection, Cytoplasm, Nucleus, Perikaryon, Peripheral membrane protein, growth cone, lamellipodium, postsynaptic cell membrane, postsynaptic density, synapse.
Customer validation	WB(Mus musculus, Homo sapiens, Mus musculus) IP(Mus musculus)