제품 > 항체 > 단일클론항체(mAb)

[KO Validated] CDK9 Rabbit mAb (A11145)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CDK9 Rabbit mAb (A11145) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Western blot analysis of lysates from wild type(WT) and CDK9 knockout (KO) 293T cells, using [KO Validated] CDK9 Rabbit mAb (A11145) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KO Validated] CDK9 Rabbit mAb (A11145)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] CDK9 Rabbit mAb (A11145) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using [KO Validated] CDK9 Rabbit mAb (A11145) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KO Validated] CDK9 Rabbit mAb (A11145) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using [KO Validated] CDK9 Rabbit mAb (A11145) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using [KO Validated] CDK9 Rabbit mAb (A11145) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using [KO Validated] CDK9 Rabbit mAb (A11145) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KO Validated] CDK9 Rabbit mAb (A11145)

Confocal imaging of U-2 OS cells using [KO Validated] CDK9 Rabbit mAb (A11145, dilution 1:50)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

ABclonal:Immunoprecipitation - [KO Validated] CDK9 Rabbit mAb (A11145)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 3 μg CDK9 antibody (A11145). Western blot was performed from the immunoprecipitate using CDK9 antibody (A11145) at a dilution of 1:1000.

Overview

Product name	[KO Validated] CDK9 Rabbit mAb
Catalog No.	A11145
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0527

Background

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. This kinase was found to be a component of the multiprotein complex TAK/P-TEFb, which is an elongation factor for RNA polymerase II-directed transcription and functions by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. This protein forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. HIV-1 Tat protein was found to interact with this protein and cyclin T, which suggested a possible involvement of this protein in AIDS.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 273-372 of human CDK9 (P50750).
Sequence	RKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
Gene ID
Swiss Prot
Synonyms	TAK; C-2k; CTK1; CDC2L4; PITALRE; K9
Calculated MW	43kDa
Observed MW	42kDa/55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:3000 IHC-P 1:200 - 1:2000 IF/ICC 1:50 - 1:400 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa, 293T , MCF7, Mouse brain, Rat testis
Cellular location	Cytoplasm, Nucleus, PML body.
Customer validation	WB(Homo sapiens, Anatinae) Co-IP(Homo sapiens)