제품 > 항체 > 단일클론항체(mAb)

[KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using CDKN2C/p18-INK4C Rabbit mAb (A8751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of extracts of HepG2 cells, using CDKN2C antibody (A8751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Western blot analysis of extracts from wild type(WT) and CDKN2C knockout (KO) 293T cells, using CDKN2C antibody (A8751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunofluorescence - [KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)

Immunofluorescence analysis of HeLa cells using CDKN2C/p18-INK4C Rabbit mAb (A8751) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review

Overview

Product name	[KO Validated] CDKN2C/p18-INK4C Rabbit mAb
Catalog No.	A8751
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1289

Background

The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CDKN2C/p18-INK4C (P42773).
Sequence	MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE
Gene ID
Swiss Prot
Synonyms	p18; INK4C; p18-INK4C
Calculated MW	18kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, 293T, NIH/3T3, Mouse lung, Mouse testis, Rat spleen, Rat kidney
Cellular location	cytoplasm, cytosol, nucleus
Customer validation	(Hela 、293T 、KYM-1 、NCl-H460 、SKOV-3 、U2-OS, hela 293t kym-1 nci-h460 skov-3 u2-0s minami-2 )