제품 > 항체 > 다중클론항체(pAb)

[KO Validated] CHRAC1 Rabbit pAb (A14896)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts from normal (control) and CHRAC1 knockout (KO) HeLa cells, using CHRAC1 antibody (A14896) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

Overview

Product name	[KO Validated] CHRAC1 Rabbit pAb
Catalog No.	A14896
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human CHRAC1 (NP_059140.1).
Sequence	MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS
Gene ID
Swiss Prot
Synonyms	YCL1; CHARC1; CHARC15; CHRAC-1; CHRAC15; CHRAC-15
Calculated MW	15kDa
Observed MW	14kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa
Cellular location	Nucleus
Customer validation	WB(Homo sapiens) IHC(Homo sapiens) IF(Homo sapiens) Co-IP(Homo sapiens) WB(Homo sapiens)