제품 > 항체 > 다중클론항체(pAb)

[KO Validated] CSDE1 Rabbit pAb (A5941)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from wild type (WT) and CSDE1 knockout (KO) HeLa cells, using [KO Validated] CSDE1 Rabbit pAb (A5941) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

ABclonal:Immunofluorescence - [KO Validated] CSDE1 Rabbit pAb (A5941)

Immunofluorescence analysis of L929 cells using CSDE1 Rabbit pAb (A5941) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] CSDE1 Rabbit pAb (A5941)

Immunoprecipitation analysis of 100 μg extracts of HeLa cells using 3 μg CSDE1 antibody (A5941). Western blot was performed from the immunoprecipitate using CSDE1 antibody (A5941) at a dilution of 1:1000.

Overview

Product name	[KO Validated] CSDE1 Rabbit pAb
Catalog No.	A5941
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables RNA stem-loop binding activity. Involved in IRES-dependent viral translational initiation; nuclear-transcribed mRNA catabolic process, no-go decay; and stress granule assembly. Located in Golgi apparatus; cytosol; and plasma membrane. Part of CRD-mediated mRNA stability complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 369-600 of human CSDE1 (NP_009089.4).
Sequence	LSAQRNHAIRIKKLPKGTVSFHSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDKVEFSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKTHSVNGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVEEGDMKGEV
Gene ID
Swiss Prot
Synonyms	UNR; D1S155E; E1
Calculated MW	89kDa
Observed MW	89kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa
Cellular location	Cytoplasm
Customer validation	WB(Homo sapiens) RIP(Homo sapiens)