Review (1)Publications (5) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | [KO Validated] Caspase-8 Rabbit mAb |
---|---|
Catalog No. | A19549 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0028 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-8 (Q14790). |
---|---|
Sequence | EELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQ |
Gene ID | |
Swiss Prot | |
Synonyms | CAP4; MACH; MCH5; FLICE; ALPS2B; Casp-8; Caspase-8 |
Calculated MW | 55kDa |
Observed MW | 57kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Jurkat, HepG2 |
Cellular location | Cytoplasm, Nucleus . |
Customer validation | (HeLa cells) WB(Homo sapiens, Mus musculus, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19549? Please let us know so that we can cite the reference in this datasheet.