제품 > 항체 > 다중클론항체(pAb)

[KO Validated] EEF1B2 Rabbit pAb (A6580)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KO Validated] EEF1B2 Rabbit pAb (A6580) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of lysates from wild type (WT) and EEF1B2 knockout (KO) 293T cells, using [KO Validated] EEF1B2 Rabbit pAb (A6580) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - [KO Validated] EEF1B2 Rabbit pAb (A6580)

Immunohistochemistry analysis of paraffin-embedded Rat spinal cord using [KO Validated] EEF1B2 Rabbit pAb (A6580) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat brain using [KO Validated] EEF1B2 Rabbit pAb (A6580) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse brain using [KO Validated] EEF1B2 Rabbit pAb (A6580) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] EEF1B2 Rabbit pAb (A6580)

Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] EEF1B2 Rabbit pAb (A6580) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	[KO Validated] EEF1B2 Rabbit pAb
Catalog No.	A6580
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human EEF1B2 (NP_001032752.1).
Sequence	MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
Gene ID
Swiss Prot
Synonyms	EF1B; EEF1B; EEF1B1; B2
Calculated MW	25kDa
Observed MW	33kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	MCF-7, HL-60, HeLa, 293T, Mouse pancreas
Cellular location	cytoplasm, cytosol, eukaryotic translation elongation factor 1 complex
Customer validation	IP(Homo sapiens)