제품 > 항체 > 다중클론항체(pAb)

[KO Validated] Edf1 Rabbit pAb (A20274)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from wild type (WT) and Edf1 knockout (KO) NIH/3T3 cells, using [KO Validated] Edf1 Rabbit pAb (A20274) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Western blot analysis of lysates from HT-29 cells, using [KO Validated] Edf1 Rabbit pAb (A20274) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Overview

Product name	[KO Validated] Edf1 Rabbit pAb
Catalog No.	A20274
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable TFIID-class transcription factor complex binding activity and transcription coactivator activity. Predicted to be involved in positive regulation of DNA binding activity. Predicted to act upstream of or within cell differentiation. Predicted to be located in cytosol; nucleolus; and nucleoplasm. Predicted to be active in nucleus. Is expressed in several structures, including central nervous system; genitourinary system; heart; liver; and retina. Orthologous to human EDF1 (endothelial differentiation related factor 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of mouse Edf1 (NP_067494.1).
Sequence	MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPKAK
Gene ID
Swiss Prot
Synonyms	MBF1; 0610008L11Rik; f1
Calculated MW	16kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HT-29, NIH/3T3
Cellular location	cytoplasm, cytosol, nucleolus, nucleoplasm, nucleus