Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Western blot analysis of extracts from wild type (WT) and FOXN2 knockout (KO) HeLa(KO) cells, using [KO Validated] FOXN2 Rabbit mAb (A22637) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
| Product name | [KO Validated] FOXN2 Rabbit mAb |
|---|---|
| Catalog No. | A22637 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC58450 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 204-431 of human FOXN2. (NP_002149.2). |
|---|---|
| Sequence | QPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSASSMAAQRCASRSSVSSLSSVDEVYEFIPKNSHVGSDGSEGFHSEEDTDVDYEDDPLGDSGYASQPCAKISEKGQSGKKMRKQTCQEIDEELKEAAGSLLHLAGIRTCLGSLISTAKTQNQKQRKK |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HTLF; N2 |
| Calculated MW | 47kDa |
| Observed MW | Refer to figures |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Hela |
| Cellular location | Nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
![ABclonal:Western blot - [KO Validated] FOXN2 Rabbit mAb (A22637)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22637_ARC58450-01_KO-WB_01.jpg?t=1715736776 "ABclonal:Western blot - [KO Validated] FOXN2 Rabbit mAb (A22637)")
