Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] Glutamine Synthetase (GLUL) Rabbit mAb |
---|---|
Catalog No. | A19641 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Glutamine Synthetase (GLUL) (GLUL) (P15104). |
---|---|
Sequence | AQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL |
Gene ID | |
Swiss Prot | |
Synonyms | GS; GLNS; PIG43; PIG59; L) |
Calculated MW | 42kDa |
Observed MW | 42kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse kidney, Mouse liver, Mouse brain, Rat brain, Rat liver, Jurkat, HepG2, SH-SY5Y |
Cellular location | Cytoplasm, Mitochondrion. |
Customer validation | IF(Mus musculus) WB(Mus musculus) IF(Mus musculus) IHC(Mus musculus, Rattus norvegicus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19641? Please let us know so that we can cite the reference in this datasheet.