제품 > 항체 > 단일클론항체(mAb)

[KO Validated] HADHA Rabbit mAb (A24608)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from Hep G2 cells, using HADHA Rabbit mAb (A24608) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from wild type(WT) and HADHA knockout (KO) 293T cells, using HADHA Rabbit mAb (A24608) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KO Validated] HADHA Rabbit mAb (A24608)

Immunohistochemistry analysis of paraffin-embedded Human kidney using HADHA Rabbit mAb (A24608) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver using HADHA Rabbit mAb (A24608) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KO Validated] HADHA Rabbit mAb (A24608)

Immunofluorescence analysis of HeLa cells using HADHA Rabbit mAb (A24608) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] HADHA Rabbit mAb (A24608)

Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug HADHA antibody (A24608 1:100). Western blot was performed from the immunoprecipitate using HADHA antibody (A23892) at a dilition of 1:5000.

Overview

Product name	[KO Validated] HADHA Rabbit mAb
Catalog No.	A24608
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61203

Background

This gene encodes the alpha subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the alpha subunit catalyzing the 3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase activities. Mutations in this gene result in trifunctional protein deficiency or LCHAD deficiency. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 545-763 of human HADHA (NP_000173.2).
Sequence	FYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ
Gene ID
Swiss Prot
Synonyms	GBP; ECHA; HADH; LCEH; MTPA; LCHAD; TP-ALPHA; HA
Calculated MW	83kDa
Observed MW	75kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:12000 IHC-P 1:200 - 1:2000 IF/ICC 1:100 - 1:400 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	Hep G2, 293T
Cellular location	Mitochondrion.