Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] Lamin B1 Rabbit pAb |
---|---|
Catalog No. | A16909 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 503-586 of human Lamin B1 (NP_005564.1). |
---|---|
Sequence | AGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM |
Gene ID | |
Swiss Prot | |
Synonyms | LMN; ADLD; LMN2; LMNB; MCPH26; B1 |
Calculated MW | 66kDa |
Observed MW | 75kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Jurkat, HT-29, HeLa, U-251MG, mouse liver, mouse brain, mouse spleen, rat liver |
Cellular location | Lipid-anchor, Nucleoplasmic side, Nucleus inner membrane. |
Customer validation | WB(Rattus norvegicus, Homo sapiens, Canis lupus familiaris, Mus musculus) IF(Homo sapiens) Co-IP(Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16909? Please let us know so that we can cite the reference in this datasheet.