제품 > 항체 > 다중클론항체(pAb)

[KO Validated] MAP3K1 Rabbit pAb (A18041)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type (WT) and MAP3K1 knockout (KO) HeLa cells, using [KO Validated] MAP3K1 Rabbit pAb (A18041) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

Western blot analysis of various lysates using MAP3K1 (A18041) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - [KO Validated] MAP3K1 Rabbit pAb (A18041)

Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using MAP3K1 Rabbit pAb (A18041) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using MAP3K1 Rabbit pAb (A18041) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using MAP3K1 Rabbit pAb (A18041) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using MAP3K1 Rabbit pAb (A18041) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using MAP3K1 Rabbit pAb (A18041) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using MAP3K1 Rabbit pAb (A18041) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using MAP3K1 Rabbit pAb (A18041) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M Tris-EDTA repair solution (pH 9.0) prior to IHC staining.

Overview

Product name	[KO Validated] MAP3K1 Rabbit pAb
Catalog No.	A18041
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1400-1512 of human MAP3K1 (NP_005912.1).
Sequence	TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
Gene ID
Swiss Prot
Synonyms	MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1; K1
Calculated MW	164kDa
Observed MW	164kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, Raji, A-431
Cellular location	cytoplasm, cytosol.