제품 > 항체 > 다중클론항체(pAb)

MAP3K1 Rabbit pAb (A16057)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MAP3K1 Rabbit pAb (A16057) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of various lysates using MAP3K1 Rabbit pAb (A16057) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunohistochemistry - MAP3K1 Rabbit pAb (A16057)

Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using MAP3K1 Rabbit pAb (A16057) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using MAP3K1 Rabbit pAb (A16057) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using MAP3K1 Rabbit pAb (A16057) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using MAP3K1 Rabbit pAb (A16057) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - MAP3K1 Rabbit pAb (A16057)

Immunofluorescence analysis of SH-SY5Y cells using MAP3K1 Rabbit pAb (A16057) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Mouse spleen tissue using MAP3K1 Rabbit pAb (A16057) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.

Overview

Product name	MAP3K1 Rabbit pAb
Catalog No.	A16057
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1400-1512 of human MAP3K1 (NP_005912.1).
Sequence	TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
Gene ID
Swiss Prot
Synonyms	MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1; MAP3K1
Calculated MW	164kDa
Observed MW	164kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:100 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	A-431, Raji, HeLa, Mouse spleen, NIH/3T3, Mouse spleen
Cellular location	cytoplasm, cytosol.
Customer validation	WB(Mus musculus) qPCR(Homo sapiens) WB(Homo sapiens)