제품 > 항체 > 다중클론항체(pAb)

[KO Validated] NRBF2 Rabbit pAb (A6462)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using NRBF2 Rabbit pAb (A6462) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Western blot analysis of lysates from HepG2 cells, using [KO Validated] NRBF2 Rabbit pAb (A6462) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Western blot analysis of lysates from wild type (WT) and NRBF2 knockout (KO) 293T cells, using [KO Validated] NRBF2 Rabbit pAb (A6462) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - [KO Validated] NRBF2 Rabbit pAb (A6462)

Immunohistochemistry analysis of paraffin-embedded Human esophageal using [KO Validated] NRBF2 Rabbit pAb (A6462) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KO Validated] NRBF2 Rabbit pAb (A6462)

Immunofluorescence analysis of C6 cells using [KO Validated] NRBF2 Rabbit pAb (A6462) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using [KO Validated] NRBF2 Rabbit pAb (A6462) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using [KO Validated] NRBF2 Rabbit pAb (A6462) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of C6 cells using NRBF2 Rabbit pAb (A6462) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using NRBF2 Rabbit pAb (A6462) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using NRBF2 Rabbit pAb (A6462) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	[KO Validated] NRBF2 Rabbit pAb
Catalog No.	A6462
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in autophagy. Located in cytoplasm. Colocalizes with phosphatidylinositol 3-kinase complex, class III.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-287 of human NRBF2 (NP_110386.2).
Sequence	MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN
Gene ID
Swiss Prot
Synonyms	COPR; COPR1; COPR2; NRBF-2; F2
Calculated MW	32kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HepG2
Cellular location	Cytoplasm, Cytoplasmic vesicle, Nucleus, autophagosome.