제품 > 항체 > 다중클론항체(pAb)

[KO Validated] POLE3 Rabbit pAb (A6469)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using [KO Validated] POLE3 Rabbit pAb (A6469) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Western blot analysis of lysates from wild type (WT) and POLE3 knockout (KO) 293T cells, using [KO Validated] POLE3 Rabbit pAb (A6469) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	[KO Validated] POLE3 Rabbit pAb
Catalog No.	A6469
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human POLE3 (NP_059139.3).
Sequence	MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
Gene ID
Swiss Prot
Synonyms	p17; YBL1; CHRAC2; CHRAC17; CHARAC17; E3
Calculated MW	17kDa
Observed MW	20-25kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2, Mouse testis, Mouse bone marrow, Mouse spleen, 293T
Cellular location	Nucleus.
Customer validation	IHC(Homo sapiens) IF(Homo sapiens) Co-IP(Homo sapiens) WB(Homo sapiens) WB(Mus musculus)