제품 > 항체 > 다중클론항체(pAb)

[KO Validated] PPP1CC Rabbit pAb (A4035)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PPP1CC antibody (A4035) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of extracts from normal (control) and PPP1CC knockout (KO) HeLa cells, using PPP1CC antibody (A4035) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - [KO Validated] PPP1CC Rabbit pAb (A4035)

Immunofluorescence analysis of H9C2 cells using [KO Validated] PPP1CC Rabbit pAb (A4035) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using [KO Validated] PPP1CC Rabbit pAb (A4035) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using [KO Validated] PPP1CC Rabbit pAb (A4035) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	[KO Validated] PPP1CC Rabbit pAb
Catalog No.	A4035
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human PPP1CC (NP_002701.1).
Sequence	MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK
Gene ID
Swiss Prot
Synonyms	PP1C; PP-1G; PPP1G
Calculated MW	37kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, HL-60, Mouse thymus, Mouse spleen, Rat brain
Cellular location	Chromosome, Cleavage furrow, Cytoplasm, Midbody, Mitochondrion, Nucleus, Nucleus speckle, centromere, kinetochore, nucleolus, nucleoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] PPP1CC Rabbit pAb images

Western blot - [KO Validated] PPP1CC Rabbit pAb (A4035)

Immunofluorescence - [KO Validated] PPP1CC Rabbit pAb (A4035)

Immunofluorescence analysis of H9C2 cells using [KO Validated] PPP1CC Rabbit pAb (A4035) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - [KO Validated] PPP1CC Rabbit pAb (A4035)

Immunofluorescence analysis of L929 cells using [KO Validated] PPP1CC Rabbit pAb (A4035) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - [KO Validated] PPP1CC Rabbit pAb (A4035)

Immunofluorescence analysis of U2OS cells using [KO Validated] PPP1CC Rabbit pAb (A4035) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.