제품 > 항체 > 단일클론항체(mAb)

[KO Validated] Rab12 Rabbit mAb [MJFF-A-6E6] (A26172)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from A549 cells using Rab12 Rabbit mAb (A26172) at 1:2000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of lysates from wild type (WT) and Rab12 knockout (KO) A-549 cells using Rab12 Rabbit mAb (A26172) at 1:100000 dilution incubated overnight at 4℃.
Secondary antibody: IRDye® 800CW Goat anti-Rabbit IgG Secondary Antibody (926-32211) at 1:25000 dilution.
Lysates/proteins: 15 μg per lane.
Blocking buffer: 5% nonfat dry milk in TBST.
Detection: LI-COR Odyssey CLx.
Exposure time: LI-COR scan using automatic sensitivity setting.

Western blot analysis of lysates from wild type (WT) and Rab12 knockout (KO) MEF cells using Rab12 Rabbit mAb (A26172) at 1:100000 dilution incubated overnight at 4℃
Secondary antibody: IRDye® 800CW Goat anti-Rabbit IgG Secondary Antibody (926-32211) at 1:25000 dilution.
Lysates/proteins: 15 μg per lane.
Blocking buffer: 5% nonfat dry milk in TBST.
Detection: LI-COR Odyssey CLx.
Exposure time: LI-COR scan using automatic sensitivity setting.

Overview

Product name	[KO Validated] Rab12 Rabbit mAb [MJFF-A-6E6]
Catalog No.	A26172
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC5158-01

Background

Rab12 is a member of the RAS oncogene family and plays a crucial role in intracellular membrane trafficking. This small GTPase protein is involved in the transport of vesicles, particularly from recycling endosomes to lysosomes, and is essential for processes like autophagy and the degradation of the transferrin receptor. Rab12 cycles between an inactive GDP-bound form and an active GTP-bound form, recruiting various effectors responsible for vesicle formation, movement, and fusion. In addition to being a substrate for phosphorylation by LRRK2 (Leucine-Rich Repeat Kinase 2), Rab12 has recently been identified as its significant regulator. It has been shown that Rab12 can activate LRRK2, leading to increased phosphorylation of Rab10, another protein involved in intracellular trafficking. This activation is particularly notable in the context of lysosomal damage, where Rab12 helps recruit LRRK2 to lysosomes, enhancing its activity. Dysregulation of this pathway due to pathogenic LRRK2 mutations can contribute to the neurodegenerative processes observed in Parkinson's disease.

Immunogen information

Immunogen	Recombinant protein containing a sequence corresponding to amino acids 1-244 of human Rab12 protein (Q6IQ22).
Sequence	MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC
Gene ID
Swiss Prot
Synonyms	RAB12
Calculated MW	27kDa
Observed MW	27kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3
Key application	Western blotting
Positive samples	A549, MEF
Cellular location	Cytoplasmic side, Cytoplasmic vesicle, Golgi apparatus membrane, Lipid-anchor, Lysosome membrane, Recycling endosome membrane, autophagosome.