제품 > 항체 > 단일클론항체(mAb)

[KO Validated] SLC25A4/ANT1 Rabbit mAb (A20842)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from MCF7 cells, using [KO Validated] SLC25A4/ANT1 Rabbit mAb (A20842) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of various lysates using [KO Validated] SLC25A4/ANT1 Rabbit mAb (A20842) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of lysates from wild type (WT) and SLC25A4/ANT1 knockout (KO) 293T cells, using [KO Validated] SLC25A4/ANT1 Rabbit mAb (A20842) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - [KO Validated] SLC25A4/ANT1 Rabbit mAb (A20842)

Confocal imaging of HeLa cells using [KO Validated] SLC25A4/ANT1 Rabbit mAb (A20842, dilution 1:100) (Red). The cells were counterstained with [KO Validated] Vimentin Rabbit mAb (A19607, dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

ABclonal:Immunoprecipitation - [KO Validated] SLC25A4/ANT1 Rabbit mAb (A20842)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg SLC25A4/ANT1 antibody (A20842). Western blot was performed from the immunoprecipitate using SLC25A4/ANT1 antibody (A20842) at a dilution of 1:1000.

Overview

Product name	[KO Validated] SLC25A4/ANT1 Rabbit mAb
Catalog No.	A20842
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51442

Background

This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SLC25A4/ANT1 (NP_001142.2).
Sequence	LGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKG
Gene ID
Swiss Prot
Synonyms	T1; ANT; AAC1; ANT1; PEO2; PEO3; ANT 1; PEOA2; MTDPS12; MTDPS12A
Calculated MW	33kDa
Observed MW	33kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:100 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	293T, MCF7, Mouse heart, Rat heart
Cellular location	Mitochondrion inner membrane, Multi-pass membrane protein.
Customer validation	WB(Rattus norvegicus)