제품 > 항체 > 단일클론항체(mAb)

[KO Validated] STAT5B Rabbit mAb (A19567)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type (WT) and STAT5B knockout (KO) HeLa cells, using [KO Validated] STAT5B Rabbit mAb (A19567) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of various lysates using [KO Validated] STAT5B Rabbit mAb (A19567) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunoprecipitation - [KO Validated] STAT5B Rabbit mAb (A19567)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg STAT5B antibody (A19567). Western blot was performed from the immunoprecipitate using STAT5B antibody (A19567) at a dilution of 1:1000.

Review

Overview

Product name	[KO Validated] STAT5B Rabbit mAb
Catalog No.	A19567
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0046

Background

The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 600-787 of human STAT5B (P51692).
Sequence	KQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS
Gene ID
Swiss Prot
Synonyms	STAT5; GHISID2; 5B
Calculated MW	90kDa
Observed MW	90kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	K-562, Mouse thymus, Mouse heart, Rat heart, HeLa
Cellular location	Cytoplasm, Nucleus
Customer validation	( MCF-7 、HepG2、A549 、T-47D 、MOLT-4、293T) WB(Mus musculus, Homo sapiens)