Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from wild type(WT) and SUCLG2 knockout (KO) 293T(KO) cells, using [KO Validated] SUCLG2 Rabbit pAb (A8976) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Human liver cancer using [KO Validated] SUCLG2 Rabbit pAb (A8976) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human lung cancer using [KO Validated] SUCLG2 Rabbit pAb (A8976) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using [KO Validated] SUCLG2 Rabbit pAb (A8976) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | [KO Validated] SUCLG2 Rabbit pAb |
|---|---|
| Catalog No. | A8976 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-300 of human SUCLG2 (NP_003839.2). |
|---|---|
| Sequence | SDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLD |
| Gene ID | |
| Swiss Prot | |
| Synonyms | G-SCS; GBETA; GTPSCS; G2 |
| Calculated MW | 47kDa |
| Observed MW | 47kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | 293T |
| Cellular location | Mitochondrion |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
![ABclonal:Western blot - [KO Validated] SUCLG2 Rabbit pAb (A8976)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A8976_P11380_KO-WB_01.jpg?t=1715131081 "ABclonal:Western blot - [KO Validated] SUCLG2 Rabbit pAb (A8976)")
![ABclonal:Immunohistochemistry - [KO Validated] SUCLG2 Rabbit pAb (A8976)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A8976_P11380_IHC_01.jpg?t=1715131081 "ABclonal:Immunohistochemistry - [KO Validated] SUCLG2 Rabbit pAb (A8976)")
![ABclonal:Immunohistochemistry - [KO Validated] SUCLG2 Rabbit pAb (A8976)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A8976_P11380_IHC_02.jpg?t=1715131081 "ABclonal:Immunohistochemistry - [KO Validated] SUCLG2 Rabbit pAb (A8976)")
![ABclonal:Immunofluorescence - [KO Validated] SUCLG2 Rabbit pAb (A8976)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A8976_P11379_IF_01.jpg?t=1715131081 "ABclonal:Immunofluorescence - [KO Validated] SUCLG2 Rabbit pAb (A8976)")
![ABclonal:Immunofluorescence - [KO Validated] SUCLG2 Rabbit pAb (A8976)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A8976_P11379_IF_02.jpg?t=1715131081 "ABclonal:Immunofluorescence - [KO Validated] SUCLG2 Rabbit pAb (A8976)")
