제품 > 항체 > 단일클론항체(mAb)

[KO Validated] SUMO1 Rabbit mAb (A19121)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KO Validated] SUMO1 Rabbit mAb (A19121) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of lysates from wild type(WT) and SUMO1 knockout (KO) 293T cells, using [KO Validated] SUMO1 Rabbit mAb (A19121) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - [KO Validated] SUMO1 Rabbit mAb (A19121)

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KO Validated] SUMO1 Rabbit mAb (A19121) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KO Validated] SUMO1 Rabbit mAb (A19121) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KO Validated] SUMO1 Rabbit mAb (A19121) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KO Validated] SUMO1 Rabbit mAb (A19121) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KO Validated] SUMO1 Rabbit mAb (A19121)

Confocal imaging of NIH/3T3 cells using [KO Validated] SUMO1 Rabbit mAb (A19121, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	[KO Validated] SUMO1 Rabbit mAb
Catalog No.	A19121
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0215

Background

This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-101 of human Sumo 1 (P63165).
Sequence	MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
Gene ID
Swiss Prot
Synonyms	DAP1; GMP1; PIC1; SMT3; UBL1; OFC10; SENP2; SMT3C; SMT3H3; O1
Calculated MW	12kDa
Observed MW	17kDa/80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:2000 - 1:10000 IF/ICC 1:200 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	SW480, HeLa, A-431, NCI-H460, 293T, Mouse testis, Mouse liver, Mouse brain, Rat testis, Rat brain
Cellular location	Cell membrane, Cytoplasm, Nucleus, Nucleus membrane, Nucleus speckle, PML body.
Customer validation	WB(Homo sapiens, Rattus norvegicus) IP(N.benthamiana)