Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Western blot analysis of various lysates using [KO Validated] TFAP4 Rabbit pAb (A16727) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of lysates from wild type (WT) and TFAP4 knockout (KO) HeLa cells, using [KO Validated] TFAP4 Rabbit pAb (A16727) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60S.
Immunofluorescence analysis of C6 cells using [KO Validated] TFAP4 Rabbit pAb (A16727) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | [KO Validated] TFAP4 Rabbit pAb |
|---|---|
| Catalog No. | A16727 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-338 of human TFAP4 (NP_003214.1). |
|---|---|
| Sequence | QQEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | AP-4; bHLHc41; P4 |
| Calculated MW | 39kDa |
| Observed MW | 42kDa |
| Reactivity | Human, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | HT-29, SGC-7901, 22Rv1, HeLa |
| Cellular location | Nucleus |
| Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16727? Please let us know so that we can cite the reference in this datasheet.
![ABclonal:Western blot - [KO Validated] TFAP4 Rabbit pAb (A16727)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16727_Q6389_WB_01.jpg?t=1709177276 "ABclonal:Western blot - [KO Validated] TFAP4 Rabbit pAb (A16727)")
![ABclonal:Western blot - [KO Validated] TFAP4 Rabbit pAb (A16727)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16727_Q6389_KO-WB_01.jpg?t=1709177276 "ABclonal:Western blot - [KO Validated] TFAP4 Rabbit pAb (A16727)")
![ABclonal:Immunofluorescence - [KO Validated] TFAP4 Rabbit pAb (A16727)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16727_Q6390_IF_01.jpg?t=1709177276 "ABclonal:Immunofluorescence - [KO Validated] TFAP4 Rabbit pAb (A16727)")
![ABclonal:Immunofluorescence - [KO Validated] TFAP4 Rabbit pAb (A16727)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16727_Q6390_IF_02.jpg?t=1709177276 "ABclonal:Immunofluorescence - [KO Validated] TFAP4 Rabbit pAb (A16727)")
