제품 > 항체 > 다중클론항체(pAb)

KPNA1 Rabbit pAb (A1742)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using KPNA1 Rabbit pAb (A1742) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - KPNA1 Rabbit pAb (A1742)

Immunohistochemistry analysis of KPNA1 in paraffin-embedded human brain tissue using KPNA1 Rabbit pAb (A1742) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KPNA1 in paraffin-embedded human kidney tissue using KPNA1 Rabbit pAb (A1742) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KPNA1 in paraffin-embedded mouse liver tissue using KPNA1 Rabbit pAb (A1742) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of KPNA1 in paraffin-embedded human colon carcinoma tissue using KPNA1 Rabbit pAb (A1742) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	KPNA1 Rabbit pAb
Catalog No.	A1742
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. This protein interacts with the recombination activating gene 1 (RAG1) protein and is a putative substrate of the RAG1 ubiquitin ligase. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human KPNA1 (NP_002255.3).
Sequence	MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRR
Gene ID
Swiss Prot
Synonyms	RCH2; SRP1; IPOA5; NPI-1; KPNA1
Calculated MW	60kDa
Observed MW	62kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HepG2, 293T, Mouse brain
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Homo sapiens, Mus musculus) Co-IP(Homo sapiens) IP(Mus musculus)